SCOPe 2.04: Domain d1a21a2: 1a21 A:107-208

Lineage for d1a21a2 (1a21 A:107-208)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)

8. Domain d1a21a2: 1a21 A:107-208 [21968]

Details for d1a21a2

PDB Entry: 1a21, 2.35 Å

PDB Description: tissue factor (tf) from rabbit

PDB Compounds: (A:) tissue factor

SCOPe Domain Sequences for d1a21a2:

Sequence, based on SEQRES records:

>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrasstgkkta
ttntneflidvdkgenycfsvqavipsrkrkqrspesltect

Sequence, based on observed residues (ATOM records):

>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtklnvtvqdartlvtflslravfgkdlnytlyywrkktattntnefli
dvdkgenycfsvqavipsrkrkqrspesltect

Timeline for d1a21a2:

• d1a21a2 first appeared (with stable ids) in SCOP 1.55
  
• d1a21a2 appears in SCOPe 2.03
  
• d1a21a2 appears in SCOPe 2.05
  
• d1a21a2 appears in the current release, SCOPe 2.08