SCOP 1.61: Domain d1a21a2: 1a21 A:107-208

Lineage for d1a21a2 (1a21 A:107-208)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)

8. Domain d1a21a2: 1a21 A:107-208 [21968]

Details for d1a21a2

PDB Entry: 1a21, 2.35 Å

PDB Description: tissue factor (tf) from rabbit

SCOP Domain Sequences for d1a21a2:

Sequence, based on SEQRES records:

>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
gqptiqsfeqvgtklnvtvqdartlvrrngtflslravfgkdlnytlyywrasstgkkta
ttntneflidvdkgenycfsvqavipsrkrkqrspesltect

Sequence, based on observed residues (ATOM records):

>d1a21a2 b.1.2.1 (A:107-208) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
gqptiqsfeqvgtklnvtvqdartlvtflslravfgkdlnytlyywrkktattntnefli
dvdkgenycfsvqavipsrkrkqrspesltect

Timeline for d1a21a2:

• d1a21a2 first appeared (with stable ids) in SCOP 1.55
  
• d1a21a2 appears in SCOP 1.59
  
• d1a21a2 appears in SCOP 1.63
  
• d1a21a2 appears in the current release, SCOPe 2.08