Lineage for d4dc3b_ (4dc3 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872643Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 1872644Protein automated matches [190117] (37 species)
    not a true protein
  7. 1872656Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226519] (5 PDB entries)
  8. 1872664Domain d4dc3b_: 4dc3 B: [219671]
    automated match to d2absa1
    complexed with 2fa, adn, cl

Details for d4dc3b_

PDB Entry: 4dc3 (more details), 2.4 Å

PDB Description: Adenosine kinase from Schistosoma mansoni in complex with 2-fluoroadenosine
PDB Compounds: (B:) adenosine kinase

SCOPe Domain Sequences for d4dc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dc3b_ c.72.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
dlsegyvfgmgnplldiivdaddfmyrkynlkkdnivlaeekhmtiydeiqkkkklnyia
ggatlntvkmiqwiiqkpfvcsyvgcigadiqgkyikndcsaldlvtefqiaeeplmtgk
vavlvseklrsmvtylgaacdlslahieqphvwslvekaqvyyiagfvintcyegmlkia
khsleneklfcfnlsapflsqfntkevdemisysnivfgneseaeaygevhglledtvha
taryiadlpfadgkkrkrlviitrgknpllytdssdseihqfmveqfkddqiidtngagd
afaagfiadyirgkpmitslhaavkaaayiicrsgfslgsrdsy

SCOPe Domain Coordinates for d4dc3b_:

Click to download the PDB-style file with coordinates for d4dc3b_.
(The format of our PDB-style files is described here.)

Timeline for d4dc3b_: