SCOPe 2.03: Domain d4dc3b_: 4dc3 B:

Lineage for d4dc3b_ (4dc3 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.0: automated matches [191321] (1 protein)
   not a true family

6. Protein automated matches [190117] (34 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226519] (5 PDB entries)

8. Domain d4dc3b_: 4dc3 B: [219671]
   automated match to d2absa1
   complexed with 2fa, adn, cl

Details for d4dc3b_

PDB Entry: 4dc3, 2.4 Å

PDB Description: Adenosine kinase from Schistosoma mansoni in complex with 2-fluoroadenosine

PDB Compounds: (B:) adenosine kinase

SCOPe Domain Sequences for d4dc3b_:

Sequence; same for both SEQRES and ATOM records:

>d4dc3b_ c.72.1.0 (B:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
dlsegyvfgmgnplldiivdaddfmyrkynlkkdnivlaeekhmtiydeiqkkkklnyia
ggatlntvkmiqwiiqkpfvcsyvgcigadiqgkyikndcsaldlvtefqiaeeplmtgk
vavlvseklrsmvtylgaacdlslahieqphvwslvekaqvyyiagfvintcyegmlkia
khsleneklfcfnlsapflsqfntkevdemisysnivfgneseaeaygevhglledtvha
taryiadlpfadgkkrkrlviitrgknpllytdssdseihqfmveqfkddqiidtngagd
afaagfiadyirgkpmitslhaavkaaayiicrsgfslgsrdsy

Timeline for d4dc3b_:

• d4dc3b_ is new in SCOPe 2.03-stable
  
• d4dc3b_ appears in SCOPe 2.04
  
• d4dc3b_ appears in the current release, SCOPe 2.08