Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
Protein automated matches [190117] (37 species) not a true protein |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [226519] (5 PDB entries) |
Domain d4dc3a_: 4dc3 A: [219670] automated match to d2absa1 complexed with 2fa, adn, cl |
PDB Entry: 4dc3 (more details), 2.4 Å
SCOPe Domain Sequences for d4dc3a_:
Sequence, based on SEQRES records: (download)
>d4dc3a_ c.72.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} lsegyvfgmgnplldiivdaddfmyrkynlkkdnivlaeekhmtiydeiqkkkklnyiag gatlntvkmiqwiiqkpfvcsyvgcigadiqgkyikndcsaldlvtefqiaeeplmtgkv avlvseklrsmvtylgaacdlslahieqphvwslvekaqvyyiagfvintcyegmlkiak hsleneklfcfnlsapflsqfntkevdemisysnivfgneseaeaygevhglledtvhat aryiadlpfadgkkrkrlviitrgknpllytdssdseihqfmveqfkddqiidtngagda faagfiadyirgkpmitslhaavkaaayiicrsgfslgsrdsys
>d4dc3a_ c.72.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} lsegyvfgmgnplldiivdaddfmyrkynlkkdnivlaeekhmtiydeiqkkkklnyiag gatlntvkmiqwiiqkpfvcsyvgcigadiqgkyikndcsaldlvtefqiaeeplmtgkv avlvsrsmvtylgaacdlslahieqphvwslvekaqvyyiagfvintcyegmlkiakhsl eneklfcfnlsapflsqfntkevdemisysnivfgneseaeaygevhglledtvhatary iadlpfadgkkrkrlviitrgknpllytdssdseihqfmveqfkddqiidgagdafaagf iadyirgkpmitslhaavkaaayiicrsgfslgsrdsys
Timeline for d4dc3a_: