Lineage for d1a21a1 (1a21 A:4-106)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160982Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 161002Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (1 PDB entry)
  8. 161003Domain d1a21a1: 1a21 A:4-106 [21967]

Details for d1a21a1

PDB Entry: 1a21 (more details), 2.35 Å

PDB Description: tissue factor (tf) from rabbit

SCOP Domain Sequences for d1a21a1:

Sequence, based on SEQRES records: (download)

>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparngnttgfpeeppfrnspeftpyldtnl

Sequence, based on observed residues (ATOM records): (download)

>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus)}
tgraynltwkstnfktilewepksidhvytvqistrlenwkskcfltaetecdltdevvk
dvgqtymarvlsyparnttgfpeeppfrnspeftpyldtnl

SCOP Domain Coordinates for d1a21a1:

Click to download the PDB-style file with coordinates for d1a21a1.
(The format of our PDB-style files is described here.)

Timeline for d1a21a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a21a2