Lineage for d4dbua_ (4dbu A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1338786Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1338787Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1338957Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 1338958Species Human (Homo sapiens) [TaxId:9606] [102052] (30 PDB entries)
    Uniprot P42330
  8. 1338992Domain d4dbua_: 4dbu A: [219668]
    automated match to d1xf0a_
    complexed with bt9, nap

Details for d4dbua_

PDB Entry: 4dbu (more details), 2.53 Å

PDB Description: crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 (akr1c3) in complex with nadp+ and 3-((4 -(trifluoromethyl)phenyl) amino)benzoic acid
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d4dbua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dbua_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypys

SCOPe Domain Coordinates for d4dbua_:

Click to download the PDB-style file with coordinates for d4dbua_.
(The format of our PDB-style files is described here.)

Timeline for d4dbua_: