![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein automated matches [190580] (4 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [226324] (1 PDB entry) |
![]() | Domain d4dbba_: 4dbb A: [219665] automated match to d1x11a_ complexed with acy, cl, gol, ipa |
PDB Entry: 4dbb (more details), 1.9 Å
SCOPe Domain Sequences for d4dbba_:
Sequence, based on SEQRES records: (download)
>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikpegesqpmtevdlfistq rikvlnadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqlia qsigqafsvayqeflranginpedlsqkeysdllntq
>d4dbba_ b.55.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} edlidgiifaanylgstqllsdktpsknvrmmqaqeavsrikqpmtevdlfistqrikvl nadtqepmmdhplrtisyiadignivvlmarrrmprsqykmichvfesedaqliaqsigq afsvayqeflrainpedlsqkeysdllntq
Timeline for d4dbba_: