SCOPe 2.08: Domain d4db1b2: 4db1 B:34-77

Lineage for d4db1b2 (4db1 B:34-77)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families)

5. Family b.34.3.0: automated matches [227148] (1 protein)
   not a true family

6. Protein automated matches [226852] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226285] (1 PDB entry)

8. Domain d4db1b2: 4db1 B:34-77 [219660]
   Other proteins in same PDB: d4db1a1, d4db1a3, d4db1b1, d4db1b3
   automated match to d2mysa1
   complexed with anp, mn

Details for d4db1b2

PDB Entry: 4db1, 2.6 Å

PDB Description: Cardiac human myosin S1dC, beta isoform complexed with Mn-AMPPNP

PDB Compounds: (B:) Myosin-7

SCOPe Domain Sequences for d4db1b2:

Sequence; same for both SEQRES and ATOM records:

>d4db1b2 b.34.3.0 (B:34-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkdvfvpddkqefvkakivsreggkvtaeteygktvtvkedqvm

Timeline for d4db1b2:

• d4db1b2 first appeared in SCOPe 2.03
  
• d4db1b2 appears in SCOPe 2.07