| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
| Family b.1.2.1: Fibronectin type III [49266] (18 proteins) |
| Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
| Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) |
| Domain d1ahwf2: 1ahw F:107-211 [21966] Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwf2 b.1.2.1 (F:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg
Timeline for d1ahwf2: