Lineage for d1ahwf2 (1ahw F:107-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 160936Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 160937Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 160982Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 160983Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 161001Domain d1ahwf2: 1ahw F:107-211 [21966]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwf2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwf2 b.1.2.1 (F:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d1ahwf2:

Click to download the PDB-style file with coordinates for d1ahwf2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwf2: