SCOP 1.59: Domain d1ahwf2: 1ahw F:107-211

Lineage for d1ahwf2 (1ahw F:107-211)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (16 proteins)

6. Protein Extracellular region of human tissue factor [49267] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)

8. Domain d1ahwf2: 1ahw F:107-211 [21966]
   Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwf2

PDB Entry: 1ahw, 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwf2:

Sequence; same for both SEQRES and ATOM records:

>d1ahwf2 b.1.2.1 (F:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

Timeline for d1ahwf2:

• d1ahwf2 first appeared (with stable ids) in SCOP 1.55
  
• d1ahwf2 appears in SCOP 1.57
  
• d1ahwf2 appears in SCOP 1.61
  
• d1ahwf2 appears in the current release, SCOPe 2.08