Lineage for d4db1b1 (4db1 B:2-33,B:78-775)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111718Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries)
  8. 2111769Domain d4db1b1: 4db1 B:2-33,B:78-775 [219659]
    Other proteins in same PDB: d4db1a2, d4db1a3, d4db1b2, d4db1b3
    automated match to d2mysa2
    complexed with anp, mn

Details for d4db1b1

PDB Entry: 4db1 (more details), 2.6 Å

PDB Description: Cardiac human myosin S1dC, beta isoform complexed with Mn-AMPPNP
PDB Compounds: (B:) Myosin-7

SCOPe Domain Sequences for d4db1b1:

Sequence, based on SEQRES records: (download)

>d4db1b1 c.37.1.9 (B:2-33,B:78-775) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdsemavfgaaapylrksekerleaqtrpfdlXqqnppkfdkiedmamltflhepavlyn
lkdrygswmiytysglfcvtvnpykwlpvytpevvaayrgkkrseapphifsisdnayqy
mltdrenqsilitgesgagktvntkrviqyfaviaaigdrskkdqspgkgtledqiiqan
paleafgnaktvrndnssrfgkfirihfgatgklasadietylleksrvifqlkaerdyh
ifyqilsnkkpelldmllitnnpydyafisqgettvasiddaeelmatdnafdvlgftse
eknsmykltgaimhfgnmkfklkqreeqaepdgteeadksaylmglnsadllkglchprv
kvgneyvtkgqnvqqviyatgalakavyermfnwmvtrinatletkqprqyfigvldiag
feifdfnsfeqlcinftneklqqffnhhmfvleqeeykkegiewtfidfgmdlqacidli
ekpmgimsileeecmfpkatdmtfkaklfdnhlgksanfqkprnikgkpeahfslihyag
ivdyniigwlqknkdplnetvvglyqksslkllstlfanyagadapiekgkgkakkgssf
qtvsalhrenlnklmtnlrsthphfvrciipnetkspgvmdnplvmhqlrcngvlegiri
crkgfpnrilygdfrqryrilnpaaipegqfidsrkgaekllssldidhnqykfghtkvf
fkagllgllee

Sequence, based on observed residues (ATOM records): (download)

>d4db1b1 c.37.1.9 (B:2-33,B:78-775) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdsemavfgaaapylrksekerleaqtrpfdlXqqnppkfdkiedmamltflhepavlyn
lkdrygswmiytysglfcvtvnpykwlpvytpevvaayrgkkrseapphifsisdnayqy
mltdrenqsilitgesgagktvntkrviqyfaviaaigdrgkgtledqiiqanpaleafg
naktvrndnssrfgkfirihfgatgklasadietylleksrvifqlkaerdyhifyqils
nkkpelldmllitnnpydyafisqgettvasiddaeelmatdnafdvlgftseeknsmyk
ltgaimhfgnmkfklkqreeqaepdgteeadksaylmglnsadllkglchpryvtkgqnv
qqviyatgalakavyermfnwmvtrinatletkqprqyfigvldiagfeifdfnsfeqlc
inftneklqqffnhhmfvleqeeykkegiewtfidfgmdlqacidliekpmgimsileee
cmfpkatdmtfkaklfdnhlgksanfqkprnikgkpeahfslihyagivdyniigwlqkn
kdplnetvvglyqksslkllstlfanyagqtvsalhrenlnklmtnlrsthphfvrciip
netkspgvmdnplvmhqlrcngvlegiricrkgfpnrilyaekllssldidhnqykfght
kvffkagllgllee

SCOPe Domain Coordinates for d4db1b1:

Click to download the PDB-style file with coordinates for d4db1b1.
(The format of our PDB-style files is described here.)

Timeline for d4db1b1: