| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
| Family b.34.3.0: automated matches [227148] (1 protein) not a true family |
| Protein automated matches [226852] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [226285] (1 PDB entry) |
| Domain d4db1a2: 4db1 A:34-77 [219658] Other proteins in same PDB: d4db1a1, d4db1a3, d4db1b1, d4db1b3 automated match to d2mysa1 complexed with anp, mn |
PDB Entry: 4db1 (more details), 2.6 Å
SCOPe Domain Sequences for d4db1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4db1a2 b.34.3.0 (A:34-77) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkdvfvpddkqefvkakivsreggkvtaeteygktvtvkedqvm
Timeline for d4db1a2: