![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (21 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [193503] (14 PDB entries) |
![]() | Domain d4daoa_: 4dao A: [219655] automated match to d4d8vb_ complexed with ade, gol |
PDB Entry: 4dao (more details), 2.22 Å
SCOPe Domain Sequences for d4daoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4daoa_ c.56.2.1 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} svhigaekgqiadtvllpgdplrakfiaetylenvecynevrgmygftgtykgkkisvqg tgmgvpsisiyvneliqsydvqnlirvgscgairkdvkvrdvilamtsstdsqmnrvafg svdfapcadfellknaydaakdkgvpvtvgsvftadqfynddsqieklakygvlgvemet talytlaakhgrkalsiltvsdhvltgeettaeerqttfhdmidvalhsv
Timeline for d4daoa_: