Lineage for d4danb_ (4dan B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1375163Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1375179Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 1375180Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 1375817Protein automated matches [190142] (16 species)
    not a true protein
  7. 1375820Species Bacillus subtilis [TaxId:1423] [193503] (13 PDB entries)
  8. 1375837Domain d4danb_: 4dan B: [219654]
    automated match to d4d8vb_
    complexed with 2fa

Details for d4danb_

PDB Entry: 4dan (more details), 2.56 Å

PDB Description: Crystal structure of the hexameric purine nucleoside phosphorylase from Bacillus subtilis in complex with 2-fluoroadenosine
PDB Compounds: (B:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4danb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4danb_ c.56.2.1 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
svhigaekgqiadtvllpgdplrakfiaetylenvecynevrgmygftgtykgkkisvqg
tgmgvpsisiyvneliqsydvqnlirvgscgairkdvkvrdvilamtsstdsqmnrvafg
svdfapcadfellknaydaakdkgvpvtvgsvftadqfynddsqieklakygvlgvemet
talytlaakhgrkalsiltvsdhvltgeettaeerqttfhdmidvalhsvs

SCOPe Domain Coordinates for d4danb_:

Click to download the PDB-style file with coordinates for d4danb_.
(The format of our PDB-style files is described here.)

Timeline for d4danb_: