Lineage for d1ahwf1 (1ahw F:4-106)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 290499Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 290500Family b.1.2.1: Fibronectin type III [49266] (20 proteins)
  6. 290548Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 290549Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 290566Domain d1ahwf1: 1ahw F:4-106 [21965]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwf1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwf1:

Sequence, based on SEQRES records: (download)

>d1ahwf1 b.1.2.1 (F:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1ahwf1 b.1.2.1 (F:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

SCOP Domain Coordinates for d1ahwf1:

Click to download the PDB-style file with coordinates for d1ahwf1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwf1: