Lineage for d1ahwf1 (1ahw F:4-106)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 54737Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 54738Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 54775Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 54776Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)
  8. 54791Domain d1ahwf1: 1ahw F:4-106 [21965]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwf1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwf1:

Sequence, based on SEQRES records: (download)

>d1ahwf1 b.1.2.1 (F:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1ahwf1 b.1.2.1 (F:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

SCOP Domain Coordinates for d1ahwf1:

Click to download the PDB-style file with coordinates for d1ahwf1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwf1: