Lineage for d4dala_ (4dal A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2515970Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2515971Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2516430Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2516431Protein automated matches [190683] (59 species)
    not a true protein
  7. 2517240Species Sinorhizobium meliloti [TaxId:266834] [226320] (9 PDB entries)
  8. 2517285Domain d4dala_: 4dal A: [219645]
    Other proteins in same PDB: d4dalb2, d4dalc2, d4dald2, d4dale2, d4dalf2, d4dalg2, d4dalh2
    automated match to d1bxsa_
    complexed with gol

Details for d4dala_

PDB Entry: 4dal (more details), 2.3 Å

PDB Description: Crystal structure of Putative aldehyde dehydrogenase from Sinorhizobium meliloti 1021
PDB Compounds: (A:) Putative aldehyde dehydrogenase

SCOPe Domain Sequences for d4dala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4dala_ c.82.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mdtqlligsrfeagteaeehilnprtgagiidlaeashaqidaavdaaerafvgwsqttp
aersnallkiadaiekeadefaalealncgkpinavkndelpaiidcwrffagavrnlha
paageylpghtsmirrdpigivgsiapwnyplmmmawklapaigggntvvfkpseqtplt
alklarliadilpegvvnvitgrgetvgnalinhpkvgmvsitgdiatgkkvlaaaaktv
krthlelggkapvivygdadleavvngirtfgyynagqdctaacriyaeagiyeklvadl
tsavstirynldddteneigplisrrqrdrvasfveraadqkhieittggrtgsdegfff
qptvvagatqedeivrrevfgpvvsvtrftgkddavawandsdyglassvwtkdiskamr
aasrlqygctwinthfmltnemphggikqsgygkdmsvyaledytavrhiminhg

SCOPe Domain Coordinates for d4dala_:

Click to download the PDB-style file with coordinates for d4dala_.
(The format of our PDB-style files is described here.)

Timeline for d4dala_: