Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) |
Family c.1.21.1: Dihydropteroate synthetase [51718] (2 proteins) |
Protein Dihydropteroate synthetase [51719] (4 species) |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [102103] (32 PDB entries) Uniprot Q81VW8 |
Domain d4dafa_: 4daf A: [219641] automated match to d1tx2a_ complexed with 0j4, so4 |
PDB Entry: 4daf (more details), 2.5 Å
SCOPe Domain Sequences for d4dafa_:
Sequence, based on SEQRES records: (download)
>d4dafa_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnvtpdsfsdggsynevdaavrhakemrdegahiid iggestrpgfakvsveeeikrvvpmiqavskevklpisidtykaevakqaieagahiind iwgakaepkiaevaahydvpiilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeni ildpgigfaktpeqnleamrnleqlnvlgypvllgtsrksfighvldlpveerlegtgat vclgiekgcefvrvhdvkemsrmakmmdamigk
>d4dafa_ c.1.21.1 (A:) Dihydropteroate synthetase {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} kwdydlrcgeytlnlnektlimgilnsynevdaavrhakemrdegahiidigsveeeikr vvpmiqavskevklpisidtykaevakqaieagahiindiwgakaepkiaevaahydvpi ilmhnrdnmnyrnlmadmiadlydsikiakdagvrdeniildpgigfaktpeqnleamrn leqlnvlgypvllgtsrksfighvldlpveerlegtgatvclgiekgcefvrvhdvkems rmakmmdamigk
Timeline for d4dafa_: