Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (24 proteins) |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries) |
Domain d1ahwc2: 1ahw C:107-211 [21964] Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahwc2 b.1.2.1 (C:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg
Timeline for d1ahwc2: