Lineage for d1ahwc2 (1ahw C:107-211)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9815Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 9816Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)
  8. 9830Domain d1ahwc2: 1ahw C:107-211 [21964]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc2

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahwc2 b.1.2.1 (C:107-211) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecmg

SCOP Domain Coordinates for d1ahwc2:

Click to download the PDB-style file with coordinates for d1ahwc2.
(The format of our PDB-style files is described here.)

Timeline for d1ahwc2: