SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4da9c1 (4da9 C:1-253)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2095904Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)
  8. 2095936Domain d4da9c1: 4da9 C:1-253 [219637]
    Other proteins in same PDB: d4da9a2, d4da9c2
    automated match to d3ri3b_
    complexed with so4

Details for d4da9c1

PDB Entry: 4da9 (more details), 2.5 Å

PDB Description: Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
PDB Compounds: (C:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d4da9c1:

Sequence, based on SEQRES records: (download)

>d4da9c1 c.2.1.0 (C:1-253) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvif
lradladlsshqatvdavvaefgridclvnnagiasivrddfldlkpenfdtivgvnlrg
tvfftqavlkamlasdarasrsiinitsvsavmtsperldycmskaglaafsqglalrla
etgiavfevrpgiirsdmtaavsgkydgliesglvpmrrwgepedignivaglaggqfgf
atgsviqadggls

Sequence, based on observed residues (ATOM records): (download)

>d4da9c1 c.2.1.0 (C:1-253) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvif
lradladlsshqatvdavvaefgridclvnnagrddfldlkpenfdtivgvnlrgtvfft
qavlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrpg
iirsrwgepedignivaglaggqfgfatgsviqadggls

SCOPe Domain Coordinates for d4da9c1:

Click to download the PDB-style file with coordinates for d4da9c1.
(The format of our PDB-style files is described here.)

Timeline for d4da9c1: