Lineage for d4da9a1 (4da9 A:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848474Species Sinorhizobium meliloti [TaxId:266834] [189876] (13 PDB entries)
  8. 2848512Domain d4da9a1: 4da9 A:1-253 [219635]
    Other proteins in same PDB: d4da9a2, d4da9c2
    automated match to d3ri3b_
    complexed with so4

Details for d4da9a1

PDB Entry: 4da9 (more details), 2.5 Å

PDB Description: Crystal structure of putative Short-chain dehydrogenase/reductase from Sinorhizobium meliloti 1021
PDB Compounds: (A:) short-chain dehydrogenase/reductase

SCOPe Domain Sequences for d4da9a1:

Sequence, based on SEQRES records: (download)

>d4da9a1 c.2.1.0 (A:1-253) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvif
lradladlsshqatvdavvaefgridclvnnagiasivrddfldlkpenfdtivgvnlrg
tvfftqavlkamlasdarasrsiinitsvsavmtsperldycmskaglaafsqglalrla
etgiavfevrpgiirsdmtaavsgkydgliesglvpmrrwgepedignivaglaggqfgf
atgsviqadggls

Sequence, based on observed residues (ATOM records): (download)

>d4da9a1 c.2.1.0 (A:1-253) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtqkarpvaivtggrrgiglgiaralaasgfdiaitgigdaegvapviaelsglgarvif
lradladlsshqatvdavvaefgridclvnnagddfldlkpenfdtivgvnlrgtvfftq
avlkamlasdarasrsiinitsverldycmskaglaafsqglalrlaetgiavfevrpgi
irsrwgepedignivaglaggqfgfatgsviqadggls

SCOPe Domain Coordinates for d4da9a1:

Click to download the PDB-style file with coordinates for d4da9a1.
(The format of our PDB-style files is described here.)

Timeline for d4da9a1: