Lineage for d1ahwc1 (1ahw C:4-106)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 proteins)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657285Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 657304Domain d1ahwc1: 1ahw C:4-106 [21963]
    Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc1

PDB Entry: 1ahw (more details), 3 Å

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)
PDB Compounds: (C:) tissue factor

SCOP Domain Sequences for d1ahwc1:

Sequence, based on SEQRES records: (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

SCOP Domain Coordinates for d1ahwc1:

Click to download the PDB-style file with coordinates for d1ahwc1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwc1: