SCOP 1.61: Domain d1ahwc1: 1ahw C:4-106

Lineage for d1ahwc1 (1ahw C:4-106)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
Protein Extracellular region of human tissue factor [49267] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
Domain d1ahwc1: 1ahw C:4-106 [21963]
Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2

Details for d1ahwc1

PDB Description: a complex of extracellular domain of tissue factor with an inhibitory fab (5g9)

SCOP Domain Sequences for d1ahwc1:

Sequence, based on SEQRES records: (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei
vkdvkqtylarvfsypagneplyenspeftpylet

SCOP Domain Coordinates for d1ahwc1:

Click to download the PDB-style file with coordinates for d1ahwc1.
(The format of our PDB-style files is described here.)

Timeline for d1ahwc1: