![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (1 family) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (16 proteins) |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) |
![]() | Domain d1ahwc1: 1ahw C:4-106 [21963] Other proteins in same PDB: d1ahwa1, d1ahwa2, d1ahwb1, d1ahwb2, d1ahwd1, d1ahwd2, d1ahwe1, d1ahwe2 |
PDB Entry: 1ahw (more details), 3 Å
SCOP Domain Sequences for d1ahwc1:
Sequence, based on SEQRES records: (download)
>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)} tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei vkdvkqtylarvfsypagnvestgsageplyenspeftpylet
>d1ahwc1 b.1.2.1 (C:4-106) Extracellular region of human tissue factor {Human (Homo sapiens)} tntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdei vkdvkqtylarvfsypagneplyenspeftpylet
Timeline for d1ahwc1: