Lineage for d4d9ln2 (4d9l N:109-210)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751696Domain d4d9ln2: 4d9l N:109-210 [219625]
    Other proteins in same PDB: d4d9lh_, d4d9li_, d4d9lj_, d4d9lk_, d4d9ll1, d4d9lm1, d4d9ln1, d4d9lo1
    automated match to d1q1jl2

Details for d4d9ln2

PDB Entry: 4d9l (more details), 2.49 Å

PDB Description: fab structure of anti-hiv-1 gp120 v2 mab 697
PDB Compounds: (N:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 697

SCOPe Domain Sequences for d4d9ln2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9ln2 b.1.1.2 (N:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte

SCOPe Domain Coordinates for d4d9ln2:

Click to download the PDB-style file with coordinates for d4d9ln2.
(The format of our PDB-style files is described here.)

Timeline for d4d9ln2: