SCOPe 2.04: Domain d4d9lm2: 4d9l M:109-210

Lineage for d4d9lm2 (4d9l M:109-210)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4d9lm2: 4d9l M:109-210 [219623]
   Other proteins in same PDB: d4d9ll1, d4d9lm1, d4d9ln1, d4d9lo1
   automated match to d1q1jl2

Details for d4d9lm2

PDB Entry: 4d9l, 2.48 Å

PDB Description: fab structure of anti-hiv-1 gp120 v2 mab 697

PDB Compounds: (M:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 697

SCOPe Domain Sequences for d4d9lm2:

Sequence; same for both SEQRES and ATOM records:

>d4d9lm2 b.1.1.2 (M:109-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkanptvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d4d9lm2:

• d4d9lm2 first appeared in SCOPe 2.03
  
• d4d9lm2 appears in SCOPe 2.05
  
• d4d9lm2 appears in the current release, SCOPe 2.08