SCOPe 2.04: Domain d4d9lm1: 4d9l M:1-108

Lineage for d4d9lm1 (4d9l M:1-108)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4d9lm1: 4d9l M:1-108 [219622]
   Other proteins in same PDB: d4d9ll2, d4d9lm2, d4d9ln2, d4d9lo2
   automated match to d1q1jl1

Details for d4d9lm1

PDB Entry: 4d9l, 2.48 Å

PDB Description: fab structure of anti-hiv-1 gp120 v2 mab 697

PDB Compounds: (M:) Light chain of Fab fragment of anti-HIV1 gp120 V2 mAb 697

SCOPe Domain Sequences for d4d9lm1:

Sequence; same for both SEQRES and ATOM records:

>d4d9lm1 b.1.1.0 (M:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvltqppsvsgapgqrvtisctgsssnigahydvhwyqqlpgtapklliygnsnrpsgv
pdrfsgsksgtsaslaitglqaedeadyycqsydsslsgyvfgtgtkvtvlgq

Timeline for d4d9lm1:

• d4d9lm1 first appeared in SCOPe 2.03
  
• d4d9lm1 appears in SCOPe 2.05
  
• d4d9lm1 appears in the current release, SCOPe 2.08