Lineage for d1tfhb2 (1tfh B:107-210)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 550820Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 550821Family b.1.2.1: Fibronectin type III [49266] (28 proteins)
    Pfam 00041
  6. 550879Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 550880Species Human (Homo sapiens) [TaxId:9606] [49268] (10 PDB entries)
  8. 550896Domain d1tfhb2: 1tfh B:107-210 [21962]

Details for d1tfhb2

PDB Entry: 1tfh (more details), 2.4 Å

PDB Description: extracellular domain of human tissue factor

SCOP Domain Sequences for d1tfhb2:

Sequence, based on SEQRES records: (download)

>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqstkvnvtvedertlvntflslrdvfgkdliytlyygkktaktntneflidvd
kgcfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1tfhb2:

Click to download the PDB-style file with coordinates for d1tfhb2.
(The format of our PDB-style files is described here.)

Timeline for d1tfhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfhb1