Lineage for d1tfhb2 (1tfh B:107-210)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105235Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 105236Family b.1.2.1: Fibronectin type III [49266] (16 proteins)
  6. 105281Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 105282Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries)
  8. 105296Domain d1tfhb2: 1tfh B:107-210 [21962]

Details for d1tfhb2

PDB Entry: 1tfh (more details), 2.4 Å

PDB Description: extracellular domain of human tissue factor

SCOP Domain Sequences for d1tfhb2:

Sequence, based on SEQRES records: (download)

>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records): (download)

>d1tfhb2 b.1.2.1 (B:107-210) Extracellular region of human tissue factor {Human (Homo sapiens)}
nlgqptiqstkvnvtvedertlvntflslrdvfgkdliytlyygkktaktntneflidvd
kgcfsvqavipsrtvnrkstdspvecm

SCOP Domain Coordinates for d1tfhb2:

Click to download the PDB-style file with coordinates for d1tfhb2.
(The format of our PDB-style files is described here.)

Timeline for d1tfhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfhb1