Lineage for d4d9ea_ (4d9e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2907391Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2907392Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2907817Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2907818Protein automated matches [190215] (38 species)
    not a true protein
  7. 2907991Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)
  8. 2908015Domain d4d9ea_: 4d9e A: [219610]
    automated match to d4d92a_
    complexed with ben, lcs

Details for d4d9ea_

PDB Entry: 4d9e (more details), 2.47 Å

PDB Description: D-Cysteine desulfhydrase from Salmonella typhimurium complexed with L-cycloserine (LCS)
PDB Compounds: (A:) D-Cysteine desulfhydrase

SCOPe Domain Sequences for d4d9ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d9ea_ c.79.1.0 (A:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mplhhltrfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflva
dalregadtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllld
lfntqiemcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqc
eevvglssvvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiag
qlaltatadihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgis
qkrfnddgpilfihtggapalfayhphv

SCOPe Domain Coordinates for d4d9ea_:

Click to download the PDB-style file with coordinates for d4d9ea_.
(The format of our PDB-style files is described here.)

Timeline for d4d9ea_: