Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (14 proteins) |
Protein Extracellular region of human tissue factor [49267] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries) |
Domain d1tfhb1: 1tfh B:5-106 [21961] |
PDB Entry: 1tfh (more details), 2.4 Å
SCOP Domain Sequences for d1tfhb1:
Sequence, based on SEQRES records: (download)
>d1tfhb1 b.1.2.1 (B:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)} ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv kdvkqtylarvfsypagnvestgsageplyenspeftpylet
>d1tfhb1 b.1.2.1 (B:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)} ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv kdvkqtylarvfsypagnveplyenspeftpylet
Timeline for d1tfhb1: