Lineage for d1tfhb1 (1tfh B:5-106)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 9780Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 9781Family b.1.2.1: Fibronectin type III [49266] (14 proteins)
  6. 9815Protein Extracellular region of human tissue factor [49267] (2 species)
  7. 9816Species Human (Homo sapiens) [TaxId:9606] [49268] (6 PDB entries)
  8. 9827Domain d1tfhb1: 1tfh B:5-106 [21961]

Details for d1tfhb1

PDB Entry: 1tfh (more details), 2.4 Å

PDB Description: extracellular domain of human tissue factor

SCOP Domain Sequences for d1tfhb1:

Sequence, based on SEQRES records: (download)

>d1tfhb1 b.1.2.1 (B:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1tfhb1 b.1.2.1 (B:5-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnveplyenspeftpylet

SCOP Domain Coordinates for d1tfhb1:

Click to download the PDB-style file with coordinates for d1tfhb1.
(The format of our PDB-style files is described here.)

Timeline for d1tfhb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfhb2