Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (23 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries) |
Domain d4d9cc_: 4d9c C: [219608] automated match to d4d92c_ complexed with ben, pmp |
PDB Entry: 4d9c (more details), 1.97 Å
SCOPe Domain Sequences for d4d9cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d9cc_ c.79.1.0 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]} rfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflvadalrega dtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllldlfntqie mcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqceevvgls svvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiagqlaltat adihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgisqkrfndd gpilfihtggapalfayhphv
Timeline for d4d9cc_: