Lineage for d4d99d_ (4d99 D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2514799Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2514800Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2515225Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2515226Protein automated matches [190215] (38 species)
    not a true protein
  7. 2515408Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)
  8. 2515443Domain d4d99d_: 4d99 D: [219601]
    automated match to d4d92a_
    complexed with ben, na, ser

Details for d4d99d_

PDB Entry: 4d99 (more details), 2.01 Å

PDB Description: salmonella typhimurium d-cysteine desulfhydrase with l-ser bound non- covalently at the active site
PDB Compounds: (D:) D-Cysteine desulfhydrase

SCOPe Domain Sequences for d4d99d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d99d_ c.79.1.0 (D:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mplhhltrfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflva
dalregadtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllld
lfntqiemcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqc
eevvglssvvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiag
qlaltatadihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgis
qkrfnddgpilfihtggapalfayhphv

SCOPe Domain Coordinates for d4d99d_:

Click to download the PDB-style file with coordinates for d4d99d_.
(The format of our PDB-style files is described here.)

Timeline for d4d99d_: