SCOPe 2.03: Domain d4d96b_: 4d96 B:

Lineage for d4d96b_ (4d96 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.0: automated matches [191338] (1 protein)
   not a true family

6. Protein automated matches [190215] (18 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries)

8. Domain d4d96b_: 4d96 B: [219593]
   automated match to d4d92c_
   complexed with 5pa, ben, so4

Details for d4d96b_

PDB Entry: 4d96, 2.09 Å

PDB Description: D-Cysteine desulfhydrase from Salmonella typhimurium complexed with 1-amino-1-carboxycyclopropane (ACC)

PDB Compounds: (B:) D-Cysteine desulfhydrase

SCOPe Domain Sequences for d4d96b_:

Sequence; same for both SEQRES and ATOM records:

>d4d96b_ c.79.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
trfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflvadalreg
adtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllldlfntqi
emcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqceevvgl
ssvvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiagqlalta
tadihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgisqkrfnd
dgpilfihtggapalfayhphv

Timeline for d4d96b_:

• d4d96b_ is new in SCOPe 2.03-stable
  
• d4d96b_ appears in SCOPe 2.04
  
• d4d96b_ appears in the current release, SCOPe 2.08