![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
![]() | Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) ![]() |
![]() | Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
![]() | Protein automated matches [190215] (38 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [187759] (13 PDB entries) |
![]() | Domain d4d96b_: 4d96 B: [219593] automated match to d4d92c_ complexed with 5pa, ben, so4 |
PDB Entry: 4d96 (more details), 2.09 Å
SCOPe Domain Sequences for d4d96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4d96b_ c.79.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} trfprlefigaptpleylprlsdylgreiyikrddvtpiamggnklrkleflvadalreg adtlitagaiqsnhvrqtaavaaklglhcvallenpigttaenyltngnrllldlfntqi emcdaltdpdaqlqtlatrieaqgfrpyvipvggssalgamgyvesaleiaqqceevvgl ssvvvasgsagthaglavglehlmpdveligvtvsrsvaeqkpkvialqqaiagqlalta tadihlwddyfapgygvpndagmeavkllaslegvlldpvytgkamaglidgisqkrfnd dgpilfihtggapalfayhphv
Timeline for d4d96b_: