Lineage for d1tfha1 (1tfh A:5-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2761786Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2761787Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. 2761845Domain d1tfha1: 1tfh A:5-106 [21959]

Details for d1tfha1

PDB Entry: 1tfh (more details), 2.4 Å

PDB Description: extracellular domain of human tissue factor
PDB Compounds: (A:) human tissue factor

SCOPe Domain Sequences for d1tfha1:

Sequence, based on SEQRES records: (download)

>d1tfha1 b.1.2.1 (A:5-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvestgsageplyenspeftpylet

Sequence, based on observed residues (ATOM records): (download)

>d1tfha1 b.1.2.1 (A:5-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
ntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeiv
kdvkqtylarvfsypagnvageplyenspeftpylet

SCOPe Domain Coordinates for d1tfha1:

Click to download the PDB-style file with coordinates for d1tfha1.
(The format of our PDB-style files is described here.)

Timeline for d1tfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tfha2