SCOPe 2.05: Domain d4d8yd_: 4d8y D:

Lineage for d4d8yd_ (4d8y D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (18 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [193503] (14 PDB entries)

8. Domain d4d8yd_: 4d8y D: [219587]
   automated match to d4d8vb_
   complexed with gol, so4

Details for d4d8yd_

PDB Entry: 4d8y, 1.61 Å

PDB Description: Crystal structure of the hexameric purine nucleoside phosphorylase from Bacillus subtilis in space group P212121 at pH 5.6

PDB Compounds: (D:) Purine nucleoside phosphorylase deoD-type

SCOPe Domain Sequences for d4d8yd_:

Sequence; same for both SEQRES and ATOM records:

>d4d8yd_ c.56.2.1 (D:) automated matches {Bacillus subtilis [TaxId: 1423]}
glvprgshmsvhigaekgqiadtvllpgdplrakfiaetylenvecynevrgmygftgty
kgkkisvqgtgmgvpsisiyvneliqsydvqnlirvgscgairkdvkvrdvilamtsstd
sqmnrvafgsvdfapcadfellknaydaakdkgvpvtvgsvftadqfynddsqieklaky
gvlgvemettalytlaakhgrkalsiltvsdhvltgeettaeerqttfhdmidvalhsvs

Timeline for d4d8yd_:

• d4d8yd_ first appeared in SCOPe 2.03
  
• d4d8yd_ appears in SCOPe 2.04
  
• d4d8yd_ is called d4d8yd1 in SCOPe 2.06
  
• d4d8yd_ appears in the current release, SCOPe 2.08, called d4d8yd1