SCOPe 2.08: Domain d4d8ka2: 4d8k A:121-226

Lineage for d4d8ka2 (4d8k A:121-226)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.0: automated matches [191409] (1 protein)
   not a true family

6. Protein automated matches [190561] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)

8. Domain d4d8ka2: 4d8k A:121-226 [219573]
   Other proteins in same PDB: d4d8ka1
   automated match to d1opka2
   complexed with gol, so4

Details for d4d8ka2

PDB Entry: 4d8k, 2.36 Å

PDB Description: crystal structure of a sh3-sh2 domains of a lymphocyte-specific protein tyrosine kinase (lck) from homo sapiens at 2.36 a resolution

PDB Compounds: (A:) Tyrosine-protein kinase Lck

SCOPe Domain Sequences for d4d8ka2:

Sequence; same for both SEQRES and ATOM records:

>d4d8ka2 d.93.1.0 (A:121-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkh
ykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

Timeline for d4d8ka2:

• d4d8ka2 first appeared in SCOPe 2.03
  
• d4d8ka2 appears in SCOPe 2.07