Lineage for d4d8ka2 (4d8k A:121-226)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965705Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2965706Protein automated matches [190561] (4 species)
    not a true protein
  7. 2965707Species Human (Homo sapiens) [TaxId:9606] [187549] (77 PDB entries)
  8. 2965831Domain d4d8ka2: 4d8k A:121-226 [219573]
    Other proteins in same PDB: d4d8ka1
    automated match to d1opka2
    complexed with gol, so4

Details for d4d8ka2

PDB Entry: 4d8k (more details), 2.36 Å

PDB Description: crystal structure of a sh3-sh2 domains of a lymphocyte-specific protein tyrosine kinase (lck) from homo sapiens at 2.36 a resolution
PDB Compounds: (A:) Tyrosine-protein kinase Lck

SCOPe Domain Sequences for d4d8ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8ka2 d.93.1.0 (A:121-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevvkh
ykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt

SCOPe Domain Coordinates for d4d8ka2:

Click to download the PDB-style file with coordinates for d4d8ka2.
(The format of our PDB-style files is described here.)

Timeline for d4d8ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d8ka1