Lineage for d4d8ka1 (4d8k A:64-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783539Domain d4d8ka1: 4d8k A:64-120 [219572]
    Other proteins in same PDB: d4d8ka2
    automated match to d1opka1
    complexed with gol, so4

Details for d4d8ka1

PDB Entry: 4d8k (more details), 2.36 Å

PDB Description: crystal structure of a sh3-sh2 domains of a lymphocyte-specific protein tyrosine kinase (lck) from homo sapiens at 2.36 a resolution
PDB Compounds: (A:) Tyrosine-protein kinase Lck

SCOPe Domain Sequences for d4d8ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d8ka1 b.34.2.0 (A:64-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfvakan

SCOPe Domain Coordinates for d4d8ka1:

Click to download the PDB-style file with coordinates for d4d8ka1.
(The format of our PDB-style files is described here.)

Timeline for d4d8ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d8ka2