| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (161 species) not a true protein |
| Species Streptococcus mutans [TaxId:1309] [224911] (1 PDB entry) |
| Domain d4c0rb_: 4c0r B: [219564] Other proteins in same PDB: d4c0ra2 automated match to d4eq9a_ complexed with cd, cl, gds |
PDB Entry: 4c0r (more details), 1.55 Å
SCOPe Domain Sequences for d4c0rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c0rb_ c.94.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
ktvtlatvgttnpfsyekkgkltgydievakevfkasdkydvkyqktewtsifsgldsdk
yqigannisytkerankylysnptasnplvlvvpkdsdiksyndiaghstqvvqgnttvp
mlqkfnknhennqvklnftsedlahqirnvsdgkydfkifekisaetiikeqgldnlkvi
dlpsdqkpyvyfifaqdqkdlqkfvnkrlkklyengtleklskkylggsylpdkkdmk
Timeline for d4c0rb_: