SCOPe 2.07: Domain d4bvhb_: 4bvh B:

Lineage for d4bvhb_ (4bvh B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.0: automated matches [191352] (1 protein)
   not a true family

6. Protein automated matches [190312] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224883] (17 PDB entries)

8. Domain d4bvhb_: 4bvh B: [219559]
   automated match to d1j8fc_
   complexed with ar6, cl, edo, gol, na, oad, ocz, zn

Details for d4bvhb_

PDB Entry: 4bvh, 1.9 Å

PDB Description: crystal structure of human sirt3 in complex with the inhibitor ex-527 and 2'-o-acetyl-adp-ribose

PDB Compounds: (B:) NAD-dependent protein deacetylase sirtuin-3, mitochondrial

SCOPe Domain Sequences for d4bvhb_:

Sequence; same for both SEQRES and ATOM records:

>d4bvhb_ c.31.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gklslqdvaeliraracqrvvvmvgagistpsgipdfrspgsglysnlqqydlpypeaif
elpfffhnpkpfftlakelypgnykpnvthyflrllhdkglllrlytqnidglervsgip
asklveahgtfasatctvcqrpfpgediradvmadrvprcpvctgvvkpdivffgeplpq
rfllhvvdfpmadlllilgtslevepfaslteavrssvprllinrdlvgplawhprsrdv
aqlgdvvhgveslvellgwteemrdlvqret

Timeline for d4bvhb_:

• d4bvhb_ first appeared in SCOPe 2.03
  
• d4bvhb_ appears in SCOPe 2.06
  
• d4bvhb_ appears in the current release, SCOPe 2.08