Lineage for d4bswb2 (4bsw B:342-445)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519729Domain d4bswb2: 4bsw B:342-445 [219555]
    automated match to d1igyb4
    complexed with edo, iod

Details for d4bswb2

PDB Entry: 4bsw (more details), 2.15 Å

PDB Description: heterodimeric fc antibody azymetric variant 2
PDB Compounds: (B:) heterodimeric fc antibody azymetric variant 2

SCOPe Domain Sequences for d4bswb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bswb2 b.1.1.0 (B:342-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvyvlppsrdeltknqvsllclvkgfypsdiavewesngqpennyltwppvldsd
gsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

SCOPe Domain Coordinates for d4bswb2:

Click to download the PDB-style file with coordinates for d4bswb2.
(The format of our PDB-style files is described here.)

Timeline for d4bswb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bswb1