Lineage for d1boy_1 (1boy 3-106)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.2: Fibronectin type III [49265] (1 family) 
Family b.1.2.1: Fibronectin type III [49266] (16 proteins) Protein Extracellular region of human tissue factor [49267] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49268] (7 PDB entries) 
Domain d1boy_1: 1boy 3-106 [21955]
Details for d1boy_1
PDB Entry: 1boy (more details), 2.2 Å
PDB Description: extracellular region of human tissue factor
SCOP Domain Sequences for d1boy_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boy_1 b.1.2.1 (3-106) Extracellular region of human tissue factor {Human (Homo sapiens)}
ttntvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltde
ivkdvkqtylarvfsypagnvestgsageplyenspeftpylet
SCOP Domain Coordinates for d1boy_1:
Click to download the PDB-style file with coordinates for d1boy_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1boy_1:
- d1boy_1 first appeared (with stable ids) in SCOP 1.55
- d1boy_1 appears in SCOP 1.59
- d1boy_1 appears in SCOP 1.63
- d1boy_1 appears in the current release, SCOPe 2.08, called d1boya1
View in 3D
