SCOPe 2.08: Domain d4bsva2: 4bsv A:342-445

Lineage for d4bsva2 (4bsv A:342-445)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4bsva2: 4bsv A:342-445 [219549]
   automated match to d1igyb4
   complexed with edo, iod

Details for d4bsva2

PDB Entry: 4bsv, 1.75 Å

PDB Description: heterodimeric fc antibody azymetric variant 1

PDB Compounds: (A:) heterodimeric fc antibody azymetric variant 2

SCOPe Domain Sequences for d4bsva2:

Sequence; same for both SEQRES and ATOM records:

>d4bsva2 b.1.1.0 (A:342-445) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprepqvyvyppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsd
gsfalvskltvdksrwqqgnvfscsvmhealhnhytqkslslsp

Timeline for d4bsva2:

• d4bsva2 first appeared in SCOPe 2.03
  
• d4bsva2 appears in SCOPe 2.07