Lineage for d4bsia_ (4bsi A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778866Species Influenza virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId:265120] [226710] (1 PDB entry)
  8. 1778867Domain d4bsia_: 4bsi A: [219547]
    Other proteins in same PDB: d4bsib_
    automated match to d1rd8a_
    complexed with nag, so4

Details for d4bsia_

PDB Entry: 4bsi (more details), 2.62 Å

PDB Description: h7n3 avian influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bsia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsia_ b.19.1.0 (A:) automated matches {Influenza virus (a/turkey/italy/214845/2002 (h7n3)) [TaxId: 265120]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslmlatgmknvpei

SCOPe Domain Coordinates for d4bsia_:

Click to download the PDB-style file with coordinates for d4bsia_.
(The format of our PDB-style files is described here.)

Timeline for d4bsia_: