SCOPe 2.05: Domain d4bsga_: 4bsg A:

Lineage for d4bsga_ (4bsg A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (23 species)
   not a true protein

7. Species Influenza a (virus a/turkey/italy/214845/2002 (h7n3)) [TaxId:265120] [226708] (1 PDB entry)

8. Domain d4bsga_: 4bsg A: [219545]
   Other proteins in same PDB: d4bsgb_
   automated match to d1rd8a_
   complexed with nag, so4

Details for d4bsga_

PDB Entry: 4bsg, 2.1 Å

PDB Description: crystal structure of an h7n3 avian influenza virus haemagglutinin

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bsga_:

Sequence; same for both SEQRES and ATOM records:

>d4bsga_ b.19.1.0 (A:) automated matches {Influenza a (virus a/turkey/italy/214845/2002 (h7n3)) [TaxId: 265120]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslmlatgmknvpei

Timeline for d4bsga_:

• d4bsga_ first appeared in SCOPe 2.03
  
• d4bsga_ appears in SCOPe 2.04
  
• d4bsga_ appears in SCOPe 2.06
  
• d4bsga_ appears in the current release, SCOPe 2.08