Lineage for d4bsga_ (4bsg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2776220Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2776221Protein automated matches [227017] (58 species)
    not a true protein
  7. 2776388Species Influenza A virus (a/turkey/italy/214845/2002(h7n3)) [TaxId:265120] [226708] (1 PDB entry)
  8. 2776389Domain d4bsga_: 4bsg A: [219545]
    Other proteins in same PDB: d4bsgb_
    automated match to d1rd8a_
    complexed with nag, so4

Details for d4bsga_

PDB Entry: 4bsg (more details), 2.1 Å

PDB Description: crystal structure of an h7n3 avian influenza virus haemagglutinin
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4bsga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsga_ b.19.1.0 (A:) automated matches {Influenza A virus (a/turkey/italy/214845/2002(h7n3)) [TaxId: 265120]}
dkiclghhavsngtkvntltergvevvnatetvertnvpricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidketmgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkdpaliiwgihhsgstt
eqtklygsgnklitvgssnyqqsfvpspgarpqvngqsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqssvqvdancegdcyhsggtiisnlpfqninsravgkcpryv
kqeslmlatgmknvpei

SCOPe Domain Coordinates for d4bsga_:

Click to download the PDB-style file with coordinates for d4bsga_.
(The format of our PDB-style files is described here.)

Timeline for d4bsga_: