Lineage for d4bsfa_ (4bsf A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1531182Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1531183Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1531708Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1531709Protein automated matches [227017] (14 species)
    not a true protein
  7. 1531794Species Influenza virus a/anhui/1/2013 (h7n9) [TaxId:11320] [226707] (6 PDB entries)
  8. 1531800Domain d4bsfa_: 4bsf A: [219544]
    Other proteins in same PDB: d4bsfb_
    automated match to d1rd8a_
    complexed with nag, so4

Details for d4bsfa_

PDB Entry: 4bsf (more details), 2.76 Å

PDB Description: human h7n9 influenza virus haemagglutinin in complex with avian receptor analogue 3'-sln
PDB Compounds: (A:) haemagglutinin ha1

SCOPe Domain Sequences for d4bsfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bsfa_ b.19.1.0 (A:) automated matches {Influenza virus a/anhui/1/2013 (h7n9) [TaxId: 11320]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpei

SCOPe Domain Coordinates for d4bsfa_:

Click to download the PDB-style file with coordinates for d4bsfa_.
(The format of our PDB-style files is described here.)

Timeline for d4bsfa_: